<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
VL98SN34hald 98SN34 Africa 1998 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ IDV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15L, K20I, M36I, R41K, I64M, H69K, L89M  
>98SN34| codons 1-99
PQITLWQRPLVTVKLGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILMEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, E40D, K49R, I135V, S162A, K173A, Q174R, D177E, I178V, T200A, Q207E, V245K, T286A, E291D, V292I, I293V, P294T, S322T, I326V, G335D, R356K, M357R, G359A, V365I, T369A, E370A, A371V, I375V, A376S, K390R, K395R, T403M  
>98SN34| codons 1-423
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICTDMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRARNPEVVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKRRAA
HTNDIKQLAAVVQKVSTESIVIWGKTPKFRLPIQRETWEAWWMEYWQATWIPEWEFVNTP
PLV

References
Author Title Citation
Vergne, L Low rate of genotypic HIV-1 drug-resistant strains in the Senegalese government initiative of access to antiretroviral therapy. AIDS, 2003