<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1813 CA4868 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC 112
2 AZT+ 3TC 56
3 3TC+ D4T+ IDV 34
4 IDV+ DDI+ DLV+ 3TC 29

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, N88S   L10LI, I13V, I15V, E35D, M36I, I62V, L63P, I93L  
>CA4868| codons 1-99
PQITLWQRPIVTVKVGGQLKEALLDTGADDTVLEDINLPGRWKPKLIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLVGPTPVNIIGRSLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, V75M, L210W, T215Y K219Q K103N, Y181C   V60I, K102R, V118I, I135T, H208Y, R211K, F214L, D218E, H221HY, L228H, R284K, T286A, I293V, E297K E138EV
>CA4867| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKRNKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNVTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGLYTPEQKYQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGAKALTEVVPLTKEAE
LEL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009