<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
VL00SN69HPD 00SN69 Africa 2000 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ D4T+ IDV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V G73S I13V, E35D, M36I, R41K, K45R, R57K, L63P, H69K, A71V, L89T  
>00SN69| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVKQYD
QIPIEICGKKVISTVLVGPTPVNVIGRNTLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       K11T, V35T, T39A, V118I, K122E, D123N, I135T, K173S, Q174K, D177E, I178V, V179I, Q197E, Q207A, R211S, F214L, V245K, D250E, A272P, A288S, E291D, I293V, P294T, G335D, R356K, M357R, G359S, V365I, A371V, I375V, A376G, T377L, A400T, T403M, E404D, E432N  
>00SN69| codons 1-434
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALTEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEVII
YQYVDDLYVGSDLEIGEHRTKIEELRAHLLSWGLYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKSLTDVVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKRRSA
HTNDIKQLTEVVQKVGLESIVIWGKTPKFKLPIQKETWETWWMDYWQATWIPEWEFVNTP
PLVKLWYQLEKNPI

References
Author Title Citation
Vergne, L Low rate of genotypic HIV-1 drug-resistant strains in the Senegalese government initiative of access to antiretroviral therapy. AIDS, 2003