<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
VL98SN46HALD 00SN46 Africa 2000 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ D4T+ IDV NA
2 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R K219E     V35T, T39L, V60I, K122P, D123E, I135V, S162A, K173T, Q174K, D177E, T200A, Q207E, R211K, V245K, D250E, A272P, T286A, E291D, V292I, I293V, P294T, E312G, S322A, G335D, R356K, M357R, R358S, G359S, Q367P, E370Q, A371V, I375V, A376S, T377L, S379C, K390R, K395R, T403M N306D
>00SN46| codons 1-420
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICLEMEKEGKISKIGPENPYNTPI
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DPEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDEKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAEDREILKGPVHGVYYDPAKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKRSSA
HTNDVKPLTQVVQKVSLECIVIWGKTPKFRLPIQRETWEAWWMEYWQATWIPEWEFVNTP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, G17E, K20I, M36I, R41K, I64M, H69K, L89M  
>00SN46| codons 1-99
PQITLWQRPLVTVRIGEQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILMEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Vergne, L Low rate of genotypic HIV-1 drug-resistant strains in the Senegalese government initiative of access to antiretroviral therapy. AIDS, 2003