<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
VL99SN61HPD 99SN61 Africa 1999 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, E35D, M36I, N37D, R41K, K45R, R57K, L63P, H69K, L89M  
>99SN61| codons 1-99
PQITLWQRPLVTVRIGGQLKEALLDTGADDTVLEDIDLPGKWKPRMIGGIGGFIKVKQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K49R, I50V, V60I, K122E, D123S, I135T, K173A, Q174K, D177E, I178V, V179I, T200A, Q207A, R211S, V245E, D250E, T286A, E291D, V292I, I293V, P294T, E297D, E312T, G335D, A355G, R356K, M357K, G359S, T362I, K366R, T369A, A371V, I375V, A376V, T377L, K395R, A400T, T403M, E404D, E430K, E432D Y146F
>99SN61| codons 1-434
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRVGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQFNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEVII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTDEAE
LELAENREILKTPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYGKKRSA
HINDVRQLAEVVQKVVLESIVIWGKTPKFKLPIQRETWETWWMDYWQATWIPEWEFVNTP
PLVKLWYQLKKDPI

References
Author Title Citation
Vergne, L Low rate of genotypic HIV-1 drug-resistant strains in the Senegalese government initiative of access to antiretroviral therapy. AIDS, 2003