<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
VL01SN55HPD 01SN55 Africa 2001 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC NA
2 AZT+ DDC NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T215Y K219R     V35T, V60I, K104R, D121Y, K122E, D177E, I178V, E203K, Q207E, R211K, K223E, V245T, D250E, A272P, K277R, Q278N, A288T, E297K, I329L, T369A, A376T, T377Q, K390R, A400T, T403I, E404D  
>01SN55| codons 1-437
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEVVI
YQYMDDLYVGSDLEIGQHRTKIKELREHLLKWGFYTPDRKHQEEPPFLWMGYELHPDKWT
VQPITLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRNLCKLLRGTKTLTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLAEAVQKITQESIVIWGKTPKFRLPIQKETWETWWIDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, E35D, M36I, R41K, Y59H, Q61N  
>01SN55| codons 1-99
PQITLWQRPLVTIKIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQHD
NILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Vergne, L Low rate of genotypic HIV-1 drug-resistant strains in the Senegalese government initiative of access to antiretroviral therapy. AIDS, 2003