<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
VL98SN10Hald 98SN10 Africa 1998 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L19K, K20I, M36I, P39T, R41K, Q61E, L63C, H69K, K70R, V82I, L89M  
>98SN10| codons 1-99
PQITLWQRPLVTVKIGGQKIEALLDTGADDTVLEEINLTGKWKPKMIGGIGGFIKVRQYD
EICIEICGKRAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y N348I     V35T, T39K, K43A, V60I, K104R, D123E, K173V, Q174K, D177E, T200A, Q207E, R211K, V245K, L283I, E291D, V292I, I293V, E312N, I329V, G335D, F346Y, R356G, M357K, R358G, G359S, T369A, A371T, T377R, K390R, A400T, E404D  
>98SN10| codons 1-421
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKELEAEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRVKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLIRGTKALTDIVPLTEEAE
LELAENREILKNPVHGVYYDPSKDLIAEVQKQGQDQWTYQIYQEPYKILKTGKYAGKGSA
HTNDVKQLAETVQKIARESIVIWGKTPKFRLPIQKETWETWWTDYWQATWIPEWEFVNTP
P

References
Author Title Citation
Vergne, L Low rate of genotypic HIV-1 drug-resistant strains in the Senegalese government initiative of access to antiretroviral therapy. AIDS, 2003