<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
VL01SN63HPD 01SN63 Africa 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ D4T+ IDV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82T L89V L10I, I13V, K14R, K20I, E35D, M36I, R41K, L63P, C67E, H69K  
>01SN63| codons 1-99
PQITLWQRPIVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKIIGGIGGFIKVRQYD
QIPIEIEGKKAIGTVLVGPTPTNIIGRNVLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11N, V35T, K49R, V60I, A98S, D123S, K173T, Q174K, D177E, T200A, E204D, Q207G, V245Q, D250E, A272P, K275Q, K281R, T286A, E291D, V292I, I293V, E297A, I329V, Q334L, G335D, F346Y, R356K, M357R, R358G, G359S, A360T, E370D, A371V, A376S, T377M, T386I, K390R, Q394R, A400V, E404D, E413D, Q428R  
>01SN63| codons 1-430
PISPIETVPVNLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKSFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEDLRGHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIQVKQLCRLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGLDQWTYQIYQEPYKNLKTGKYAKRGST
HTNDVKQLTDVVQKISMESIVIWGKIPKFRLPIRKETWEVWWTDYWQATWIPDWEFVNTP
PLVKLWYRLE

References
Author Title Citation
Vergne, L Low rate of genotypic HIV-1 drug-resistant strains in the Senegalese government initiative of access to antiretroviral therapy. AIDS, 2003