<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
VL01SN160HALD 01SN160 Africa 2001 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ D4T+ IDV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  N88D T12S, I15V, E35D, M36I, R41K, Q61N, I62V, L63P, A71T Q7L
>01SN160| codons 1-99
PQITLWLRPLVSIKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
NVPIEICGHKTIGTVLVGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39A, E40D, K49R, V60I, K122E, I135R, E169D, D177E, I178V, T200A, I202V, E204K, Q207E, R211K, F214L, V245T, D250E, A272P, K277R, Q278N, T286A, E297K, E308R, I329L, R356K, T369A, I375V, T377Q, S379C, K390R, A400T, T403I, E404D, N418D, K424I  
>01SN160| codons 1-429
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICADMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPEVVI
YQYMDDLYVGSDLEIGQHRAKVEKLREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRNLCKLLRGAKALTEVIPLTKEAE
LELAENRRILKEPVHGVYYDPSKDLIAELQKQGQGQWTYQIYQEPFKNLKTGKYAKMRGA
HTNDVKQLAEAVQKVAQECIVIWGKTPKFRLPIQKETWETWWIDYWQATWIPEWEFVDTP
PLVILWYQL

References
Author Title Citation
Vergne, L Low rate of genotypic HIV-1 drug-resistant strains in the Senegalese government initiative of access to antiretroviral therapy. AIDS, 2003