<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
VL99SN74HALD 99SN74-1 Africa 1999 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ D4T NA
2 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13A, K20I, M36I, R41K, H69K, L89M  
>99SN74-1| codons 1-99
PQITLWQRPLVTAKIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35L, E36D, S68N, V90I, K122Q, I135V, S162A, K166R, K173E, Q174R, D177E, T200A, Q207E, R211K, V245Q, A272V, K277R, T286A, E291D, V292I, I293V, P294T, S322T, I326V, G335D, M357R, R358K, G359S, A371V, I375V, T403M, E432D  
>99SN74-1| codons 1-434
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLDICTEMEKEGKISKIGPENPYNTPV
FAIKKKDNTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DQDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTRILEPFRERNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYVGIKVRQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYARRKSA
HTNDVKQLTEVVQKVATESIVIWGKTPKFKLPIQKETWEAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPI

References
Author Title Citation
Vergne, L Low rate of genotypic HIV-1 drug-resistant strains in the Senegalese government initiative of access to antiretroviral therapy. AIDS, 2003