<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82A L24I, K43T L10I, T12Q, L19I, Q61R, L63P, A71V, I93L  
>MLpat8_b| codons 1-99
PQITLWQRPIVQIKIGGQIKEALIDTGADDTVLEEMNLPGRWTPKIIGGIGGFVKVRQYD
RIPIEICGHKVIGTVVVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Mueller, SM Susceptibility to saquinavir and atazanavir in highly protease inhibitor(PI) resistant HIV-1 is caused by lopinavir-induced drug resistance mutation L76V. Antivir Ther, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005