<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MSM_pat3 MLpat3_c Germany 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82A, I84V L33F, K43T L10V, I13V, N37ND, L63P, L89M  
>MLpat3_c| codons 1-99
PQITLWQRPVVTVKIGGQLKEALLDTGADDTVFEEMDLPGRWTPKIIGGIGGFVKVRQYD
QIPIEICGHKAIGTVVVGPTPANVIGRNMLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Mueller, SM Susceptibility to saquinavir and atazanavir in highly protease inhibitor(PI) resistant HIV-1 is caused by lopinavir-induced drug resistance mutation L76V. Antivir Ther, 2004