Isolate Data
Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
MSM_pat1 | MLpat1_d | Germany | 2002 | HIV1 | B | Plasma | None |
Treatment History
Order | Regimen | Weeks |
1 | PI | NA |
Protease Sequence
PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
V32I, M46I, I54M, L90M | F53L, G73S, L89V | L10I, I13V, K14R, L19I, K20R, E35D, M36I, N37Q, R57K, L63P, A71V, V77I, I85V | K43P |
>MLpat1_d| codons 1-99 PQITLWQRPIVTVRIGGQIREALLDTGADDTILEDIQLPGRWPPKIIGGIGGLMKVKQYD QIPIEICGHKVISTVLIGPTPVNIVGRNVMTQIGCTLNF |
References
Author | Title | Citation |
Mueller, SM | Susceptibility to saquinavir and atazanavir in highly protease inhibitor(PI) resistant HIV-1 is caused by lopinavir-induced drug resistance mutation L76V. | Antivir Ther, 2004 |
Rhee, SY | HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. | J Infect Dis, 2005 |