<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MSM_pat1 MLpat1_b Germany 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I54M, L90M F53L, G73S, L89V L10I, I13V, K14R, L19I, E35D, N37Q, R57K, L63P, A71V, V77I  
>MLpat1_b| codons 1-99
PQITLWQRPIVTVRIGGQIKEALLDTGADDTILEDMQLPGRWKPKIIGGIGGLMKVKQYD
QIPIEICGHKVISTVLIGPTPVNIIGRNVMTQIGCTLNF

References
Author Title Citation
Mueller, SM Susceptibility to saquinavir and atazanavir in highly protease inhibitor(PI) resistant HIV-1 is caused by lopinavir-induced drug resistance mutation L76V. Antivir Ther, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005