<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1341 CA48551 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 AZT+DDI 100
3 AZT+DDC 40
4 D4T 26
5 AZT 38
6 3TC+AZT+IDV 72
7 3TC+AZT+DLV+RTV+SQV 38
8 3TC+ADV+AZT+EFV+NFV+SQV 53
9 ABC+ADV+EFV 26
10 ADV+APV+D4T+DDI 29
11 3TC+APV+AZT 18
12 3TC+APV+AZT+LPV 86
13 3TC+APV+AZT+LPV+TDF 8

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M L33F, Q58E, G73A L10I, V11L, G16A, L19I, R41K, K55R, D60E, I62V, L63P, I64M, A71I, I72M, V77I, I93L  
>CA48551| codons 1-99
PQITLWQRPILTIKIAGQIKEALLDTGADDTVFEEMNLPGKWKPKLIGGIGGFVRVREYE
QVPMEICGHKIMATVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y   K103N   E6K, V35M, T39E, E44D, V111I, V118I, K122E, M164L, Q174R, G196E, Q197K, Q207E, R211K, Q278H, T286A, I293V  
>CA48552| codons 1-300
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALMEICEELEKDGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDIGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSLTKILEPFRKRNPDIVI
YQYVDDLYVGSDLEIEKHRTKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKHLCKLLRGAKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005