<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1809 CA4855 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 156
2 D4T+ 3TC 52
3 NFV+ 3TC+ D4T 85

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L23I I13V, K14R, I15V, K20T, E35G, R41K, I64V, V77I, V82I, I93L  
>CA4855| codons 1-99
PQITLWQRPLVTVRVGGQLTEAILDTGADDTVLEGMNLPGKWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLIGPTPINIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V T215V, K219Q     K43KE, T69N, K103R, V118I, I135L, G196E, R211K, F214L  
>CA4854| codons 1-254
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEEEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLKWGLVTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTV

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. J Infect Dis, 2001
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005