<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA21093 CA48499 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA
2 3TC+D4T+NFV 114
3 None 44
4 3TC+D4T+TDF 17
5 3TC+AZT+TDF 31

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, I15V, E35D, N37D, L63Q, I64V, E65D  
>CA48499| codons 1-99
PQITLWQRPLVTIRVGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QIQVDICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y181YC   V35VI, I47L, I50V, K166R, G196E, Q207E, R211K, L228LR, V245E, A272P, K277R, T286A, E297R  
>CA48500| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKLSKVGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
CQYMDDLYVGSDLEIEQHRTKIEELREHLLKWGFTTPDKKHQKEPPFRWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTREAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005