<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA21076 CA48465 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 100
2 AZT+DDC 78
3 D4T+DDI+NVP 35
4 3TC+AZT+NFV 291
5 3TC+AZT+NFV+TDF 47

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   L33V, K45I, A71V  
>CA48465| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVVEEMNLPGRWKPIMIGGIGGFIKVRQYD
QILIEICGHKVIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, T215Y       T69N, D123E, A158S, I178M, V179I  
>CA48466| codons 1-268
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDMII
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWAS

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009