<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4908 CA48444 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 109
2 AZT+DDI 61
3 AZT+DDI+SQV 61
4 3TC+AZT+NVP 17
5 3TC+AZT+NFV 26
6 EFV+RTV+SQV 20
7 ABC+D4T+DDI 32
8 ABC+EFV+RTV+SQV 31
9 ABC+D4T+LPV 82
10 3TC+ABC+LPV+TDF 102

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, Y115F, M184V, L210W, T215Y K219KN V106A, G190A V179D, F227L K20KR, V35I, T39A, K43Q, V60VI, W88WCS, V118VI, D123E, Q174QR, D177E, V189I, G196E, I202V, R211K, T286A, I293IV, E297K  
>CA48444| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICAELEQEGKISKIGPENPYNTPI
FAIKKKNSTKWRKIVDFRELNKRTQDFSEVQLGIPHPAGLKKKKSATVLDVGDAFFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPEIDI
YQYVDDLYIASDLEIEQHRTKVEELRQHLWKWGFYTPDNKHQKEPPLLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTKEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I47IV, I54V, I84V, L90M L10F, V11I, Q58E, G73S I15V, G16A, L19LIPT, K20I, M36I, L63P, A71V, I72L, P79X, N83S, I85V, T91S  
>CA48443| codons 1-99
PQITLWQRPFITIKVAGQTIEALLDTGADDTVLEEINLPGRWKPKMVGGIGGFVKVREYD
QIPIEICGHKVLSTVLVGXTPVSVVGRNLMSQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009