<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA21042 CA48398 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NFV 39
2 3TC+D4T+LPV+NVP 134

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74I, M184V   K103N P225H K11R, I31L, K104R, K122E, I142V, R211K, L228R, T240A, V245E, D250E, A272P, K277R, L283I, P294S, T296S, E297K, K311R, D320E, G333E, Q334H, R356K, M357I  
>CA48398| codons 1-370
PISPIETVPVRLKPGMDGPKVKQWPLTEEKLKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKNRSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEHPFRWMGYELHPDKWA
VQPIELPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGTKALTEVISLSKEAE
LELAENREILREPVHGVYYEPSKDLIAEIQKQEHGQWTYQIYQEPFKNLKTGKYAKIRGA
HTNDVKQLTE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L10F N37S, R41K, L63A  
>CA48397| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEEMSLPGKWKPKIIGGIGGFVKVRQYD
QIAIEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009