<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA21008 CA48325 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T 52
2 3TC+D4T+RTV 30
3 3TC+D4T+DDI 157
4 None 31
5 3TC+D4T+DDI 74
6 3TC+ABC+DDI 44

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L63S  
>CA48325| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QISIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, M184MV       I135T, S162SC, I178M, Q207H, R211K, F214FL, E248EG, A272P, K277R, A288AT, E297T  
>CA48326| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGQHRTKIEELRHHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPGKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKTLTEVIPLTTEAE

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009