<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA21001 CA48312 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV+RTV 9
2 3TC+D4T+EFV 5
3 3TC+D4T+NVP 156

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, M184V   Y181C V108I V8I, R83K, K166R, G196E, H221Y, A272S, E308A, K347Q  
>CA48312| codons 1-349
PISPIETIPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKRKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
CQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENRAILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFQNL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    R57K, L63P, C67S, V77I  
>CA48311| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVKQYD
QIPIEISGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009