<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA20992 CA48292 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 133
2 None 29
3 3TC+AZT+EFV 11
4 None 56
5 3TC+AZT+LPV 86
6 None 63
7 3TC+ATV+AZT+RTV+TDF 27

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I50IV, A98S, K122E, K173N, Q174K, T200E, R211K, A272P, I293V, Y339F  
>CA48292| codons 1-368
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKVGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRNKNPDIVI
YQYMDDLYVGSDLEIGQHREKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTFQIYQEPFKNLKTGKYARMRGA
HTNDVKQL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15IV, G16GE, M36I, P39S, R41K, I62V, L63P, I64V  
>CA48291| codons 1-99
PQITLWQRPLVTIKVEGQLKEALLDTGADDTVLEEINLSGKWKPKMIGGIGGFIKVRQYD
QVPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005