<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA17609 CA48264 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+LPV 35

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       M16MT, V35L, T39A, S48T, R83K, V90I, A98S, K122E, S162Y, G196E, T200A, R211T, V245E, I293V, E297R  
>CA48264| codons 1-301
PISPIETVPVKLKPGTDGPKVKQWPLTEEKIKALLEICAELEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEIQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRAKIEELRQHLLTWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTREAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M F53L L10I, R41K, D60E, Q61E, I62V, L63P, A71V, I72T, V77I  
>CA48263| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGLVKVRQYE
EVPIEICGHKVTGTVLIGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009