<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4771 CA48253 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 61
2 3TC+AZT+IDV 202
3 D4T+EFV+RTV+SQV 87
4 3TC+ABC+AZT 81
5 D4T+DDI+LPV+TDF 87

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82A, L90M   L10V, T12P, Q18M, I62IV, L63P, H69R, A71V, I72V, I93L  
>CA48253| codons 1-99
PQITLWQRPVVPIKIGGMLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVRQYD
QVPIEICGRKVVGTVVVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70E, L210W, T215Y       V35T, T39A, K49R, K66K_*TTKK, S68R, V118VI, K122E, D123S, I135T, S162D, I178M, G196GR, T200A, R211K, V245T, E248D, R284RK, I293V, E297K  
>CA48254| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAELEKEGKISRIGPENPYNTPV
FAIKKKDRTEWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIRQHRAKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGTKALTEVVPLTKEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005