<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA16120 CA48241 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 80
2 D4T+DDI+RTV+SQV 94

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M G73S L10I, K20R, E35D, M36I, N37D, R57K, L63P, A71V, I93L  
>CA48241| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHKVISTVLVGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q     K20R, V60I, T69N, K122E, D123N, I135V, I178IM, I195L, G196E, T200TA, E203G, Q207EG, V245K, E248ED, D250DE, A272P, K277R, T286A, G333E, Q367L  
>CA48242| codons 1-368
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLELEQHRAKIGELRGHLLRWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIKLPDKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQEQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKLL

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010