<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5275 CA48240 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 57
2 D4T+DDI+NFV 61
3 3TC+D4T+IDV+RTV 161
4 EFV+LPV+SQV 65

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215CDGY   K103N V108I K20R, V35I, R83K, K102KQ, K122E, I135T, D177E, I178L, Q207E, R211K, V245K, A272P, R284K, T286A, E297K  
>CA48240| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKQNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPELVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLKGAKALTEVIPLTKEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K20R, E35D, M36I, N37D, I62V, L63R, I64V, K70E, I72IV, T74S, Q92K  
>CA48239| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFIKVRQYD
QVRVEICGHEAVGSVLVGPTPVNIIGRNLLTKIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005