<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7111 CA48205 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI NA
2 3TC+D4T+EFV 135
3 3TC+D4T+EFV+LPV 115

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A   L10I, T12P, K14R, K20R, E35D, N37D, L63P, A71T, V77I, I93L  
>CA48205| codons 1-99
PQITLWQRPIVPIRIGGQLREALLDTGADDTVLEDMDLPGRWKPKMIVGIGGFVKVRQYD
QIPIEICGHKTIGTVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, Y115F   K103N V179E V35M, D177E, Q207E, R211K, F214L, L228H, K277R, T286A, E291D, E297R  
>CA48206| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAFFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIEI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGLTTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTDVIPLTREAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005