<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7983 CA48199 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+DDI+IDV 222
2 3TC+D4T+NFV+NVP 13
3 3TC+DDI+IDV 183

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M G73S L10I, I13V, K14R, I15V, K20KM, N37D, K45R, Q61E, I62V, L63P, I66L, A71T, I72R, V77I, I93L, C95V  
>CA48199| codons 1-99
PQITLWQRPIVTVRVGGQLMEALLDTGADDTVLEEMDLPGRWKPRMIGGIGGFIKVRQYD
EVPIELCGHKTRSTVLIGPTPVNVIGRNLMTQLGVTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184V K219KE K101E, Y181C   A98AS, K122E, D123N, I135T, Q174R, I178M, V179I, E194ED, G196E, T200I, L228LR, E248ED, T286A, E297KR  
>CA48200| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPSGLEKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPDMII
CQYVDDLYVGSDLDIEQHRIKIEELRQHLLRWGFTTPDEKHQKEPPFRWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTREAE
LE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005