<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5046 CA48197 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 22
2 None 100
3 3TC+AZT 9
4 3TC+AZT+IDV 39
5 3TC+D4T+SQV 35
6 AZT+RTV+SQV 26
7 AZT+DDI+RTV+SQV 30
8 ABC+D4T+EFV 57
9 ABC+APV+D4T+LPV+NVP 52
10 D4T+DDI+LPV 178
11 None 5

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S T12A, I13V, K14R, I62V, L63P, A71V, I72M, V77I  
>CA48197| codons 1-99
PQITLWQRPLVAVRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVMSTVLIGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R K219Q K103N, Y181C   K20R, T39TI, V60I, I135T, D177E, I178M, E203K, H221Y, L228R, V245T, I293V  
>CA48198| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICIEMEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
CQYMDDLYVGSDLEIGQHRTKIKELRQHLLRWGFTTPDQKYQKEPPFRWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005