<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1289 CA48195 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 4
2 D4T 17
3 3TC+D4T 9
4 3TC+D4T+SQV 48
5 3TC+D4T+NFV 25
6 3TC+D4T+RTV+SQV 255
7 3TC+RTV+SQV+TDF 15
8 3TC+RTV+SQV 10
9 DDI+EFV+LPV+TDF 2
10 None 14
11 Unknown 46

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, I84V, L90M V11I, K43T, G73S L10I, I15V, L19P, K20I, M36MI, N37D, R57RK, I62V, L63P, A71V, P79S  
>CA48195| codons 1-99
PQITLWQRPIITIKVGGQPIEALLDTGADDTVLEEIDLPGRWTPKMIGGIGGFLKVKQYD
QVPIEICGHKVISTVLVGSTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70G, M184V K219Q     K20R, V35I, I142IV, S162N, K166KQR, D218DE, L228LH, K277R, I293IV, K311KR, V317VA, Q334R, G335D, P345Q, M357T, G359S  
>CA48196| codons 1-371
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTGWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQNSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPEQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVPLTEEAE
LELAENREILREPVHGAYYDPSKDLIAEIQKQGRDQWTYQIYQEQFKNLKTGKYARTRSA
HTNDVKQLTEA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005