<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1829 CA48175 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 41
2 AZT+D4T+DDC 52
3 3TC+D4T 39
4 3TC+IDV 32
5 3TC+DLV+NFV 65
6 ADV+IDV+NFV+SQV 28
7 ABC+ADV+IDV+NFV+SQV 11
8 ABC+ADV 20
9 None 35
10 3TC+ABC+EFV+RTV+SQV 96
11 3TC+EFV+RTV+SQV 78
12 3TC+ATV+EFV+RTV 29

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    M36I, I62V, L63S, V82I  
>CA48175| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QVSIEICGHKAIGTVLVGPTPINIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W A62V, D67E, T215C K103N, Y181C V108I K20R, S68S_SV, K122E, D177E, L228H, V245E, A272P, I293V, E297K  
>CA48176| codons 1-299
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FVIKKKESTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYVDDLYVGSDLEIGQHRTKIEELRQHLWRWGFCTPDKKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTKEA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005