<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1144 CA48172 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 DDI 57
3 AZT+DDI 8
4 AZT+DDC 35
5 3TC+D4T 13
6 AZT+D4T+RTV+SQV 57
7 AZT+D4T+RTV+SQV 31
8 3TC+D4T+NFV 17
9 3TC+D4T+NFV+NVP 52
10 3TC+D4T+NFV+NVP 26
11 3TC+D4T+IDV+RTV 233
12 3TC+IDV+RTV+TDF 16

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V, T215F K219Q     V35M, V118I, K122E, I135T, S162AD, V179I, I202V, F214L, L228H, A272P, K277R, A288AT  
>CA48172| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRTKVEELRQHLLRWGLFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKTLTEVIPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54A, V82AT, L90M Q58E L10V, T12TK, L19I, F53Y, D60DE, Q61E, I62V, L63P, A71V, I72V, T74S, V77I, I93L Q18Q*HY
>CA48171| codons 1-99
PQITLWQRPVVKIKIGGYIKEALLDTGADDTVLEEMNLPGRWKPKLIVGIGGYAKVREYE
EVPIEICGHKVVGSVLIGPTPTNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012