<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4164 CA48165 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 52
2 3TC+AZT+NFV 52
3 D4T+DDI+NVP+RTV 71
4 3TC+AZT+IDV+RTV 22
5 3TC+APV+AZT+RTV 13
6 AZT+DDI+IDV+SQV 13
7 3TC+DDI+TDF 52
8 3TC+ATV+DDI+RTV+TDF 42

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I54V L10F, G73S, N88D I13V, I15V, K20T, E35D, M36I, N37D, I62V, L63P, V77I, I93L  
>CA48165| codons 1-99
PQITLWQRPFVTVKVGGQLTEALLDTGADNTVLEDIDLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKAISTVLIGPTPVNIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, M184V     V179E S68G, R83RK, K102R, K122KE, S163T, K173N, Q174K, D177G, Q207E, R211K, V245T, E248ED, A272P, R284K, T286A, I293V  
>CA48166| codons 1-296
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKRKDGTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSTMTKILEPFRNKNPGIEI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLKGAKALTEVVPLT

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005