<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5004 CA48139 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 13
2 None 65
3 D4T+EFV+RTV+SQV 30
4 None 91
5 D4T+DDI+NVP 13
6 3TC+D4T+NVP 52
7 3TC+APV+D4T+NFV+TDF 4
8 None 35
9 3TC+LPV+TDF 57

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I62V, L63A, G68E, A71V, V77I, I93L  
>CA48139| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVAIEICEHKVIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69TADN       D123E, I142T, T165I, K173N, Q174K, D177E, G196E, Q197K, T200A, R211RK, A272P, I293V, M357V  
>CA48140| codons 1-367
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSPAIFQSSMIKILEPFRNKNPEIVI
YQYMDDLYVGSDLEIEKHRAKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARVRGA
HTNDVKQ

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005