<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1855 CA48127 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 D4T 13
3 D4T+DDI+EFV+NFV+Unknown 28
4 ABC+APV+RTV+SQV 32
5 3TC+APV+RTV+SQV 74
6 3TC+ABC+D4T+DDI+EFV+LPV+TDF 35
7 3TC+ABC+APV+D4T+DDI+RTV+TDF 21
8 D4T+DDI+EFV+TDF 14
9 3TC+D4T+DDI+EFV+T20+TDF 38
10 3TC+D4T+DDI+LPV+TDF 37

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, I84V, L90M L33F, T74P L10I, I13V, N37D, D60E, L63P, A71V, V77I, I93L  
>CA48127| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVFEEMDLPGRWKPKLIGGIGGFVKVRQYE
QIPIEICGHKVIGPVLIGPTPANVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y   K103N P225PH K22N, T39A, E44D, V118I, I142V, K173E, Q207E, R211K, A272P, Q278H, K281R, I293V  
>CA48128| codons 1-304
PISPIETVPVKLKPGMDGPKVNQWPLTEEKIKALVEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEHPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKHLCRLLRGTKALTEVVPLTEEAE
LELA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005