<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6585 CA48124 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 6
2 D4T+DDI+RTV+SQV 17
3 ABC+EFV+NFV+NVP 41
4 3TC+APV+AZT+RTV 37
5 3TC+D4T+LPV+NVP 76
6 D4T+DDI+TDF 17
7 3TC+ABC+AZT+DLV+SQV+T20 11
8 3TC+AZT+DLV+SQV+T20 70

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69AD, M184MV, L210W, T215Y K219KR Y188L A98AG K20KR, V35I, T39A, K43Q, E44D, V118I, K122E, I135T, V179VI, G196E, T200A, E203K, Q207E, H208FY, R211K, H221HL, K223Q, V245E S3A
>CA48124| codons 1-249
PIAPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICAELEQDGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLLVGSDLEIEQHRAKIKELREYLWKWGFYTPDRKLQQEPPFLWMGYELHPDKWT
VQPIELPEK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46MI, I47V, I54M, V82A, L90M L33F, K43T, G73S, L89V L10V, T12D, I13V, I15V, K20M, E35ED, M36ML, D60E, Q61DN, I62V, L63P, C67Y, H69K, A71I, I72L, V77I  
>CA48123| codons 1-99
PQITLWQRPVVDVKVGGQLMEALLDTGADDTIFEDLNLPGRWTPKIVGGIGGFMKVRQYE
NVPIEIYGKKILSTVLIGPTPANIIGRNVMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012