<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6585 CA48122 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 6
2 D4T+DDI+RTV+SQV 17
3 ABC+EFV+NFV+NVP 41
4 3TC+APV+AZT+RTV 37
5 3TC+D4T+LPV+NVP 76
6 D4T+DDI+TDF 17
7 3TC+ABC+AZT+DLV+SQV+T20 11
8 3TC+AZT+DLV+SQV+T20 65

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y   Y188L A98G, Y318F V35I, T39A, K43Q, E44D, V118I, K122E, I135T, V179I, G196E, T200A, E203K, Q207E, H208F, R211K, H221L, K223Q, V245E, A272P, T286A, I293V, E297R, G333D S3A
>CA48122| codons 1-351
PIAPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAELEQDGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLLVGSDLEIEQHRAKIKELREFLWKWGFYTPDKKLQQEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVPLTREAE
LELAENREILKEPVHGVFYDPSKDLIAEIQKQDQGQWTYQIYQEPFKNLKT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, V82A, L90M L33F, K43T, G73S, L89V L10V, T12D, I13V, I15V, K20M, E35D, M36L, D60E, Q61D, I62V, L63P, C67Y, H69K, A71I, I72L, V77I  
>CA48121| codons 1-99
PQITLWQRPVVDVKVGGQLMEALLDTGADDTIFEDLNLPGRWTPKIVGGIGGFMKVRQYE
DVPIEIYGKKILSTVLIGPTPANIIGRNVMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005