<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1595 CA48120 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+IDV 117
2 3TC+D4T+DDI+EFV+RTV+SQV 178
3 3TC+D4T+DDI+RTV+SQV 118

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y V75M   V108I V35I, T39A, K43Q, E44D, T107A, L109V, V118I, K122E, D123E, S162C, I178L, V179I, V189I, G196E, H208Y, R211K, A272P, E297Q  
>CA48120| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAELEQDGKISKIGPENPYNTPV
FAIKKKNSDKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVAIVDVGDAYFSIPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDLII
YQYVDDLYIGSDLEIEQHRTKIEELRQYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTQEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54A, V82T   L10I, I13V, L19V, K20R, E35D, M36I, N37D, I62V, L63P, I66F, A71I  
>CA48119| codons 1-99
PQITLWQRPIVTVKIGGQVREALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFAKVRQYD
QVPIEFCGHKIIGTVLVGPTPTNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005