<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1420 CA48113 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 59
2 DDC 71
3 D4T 25
4 D4T+ SQV 6
5 D4T+ 3TC+ SQV 3
6 D4T+ 3TC+ RTV+ NVP 23
7 D4T+ RTV+ 3TC+ IDV 13
8 D4T+ 3TC+ IDV 40
9 D4T+ NFV+ 3TC 17
10 D4T+ NFV+ 3TC+ SQV 11
11 D4T+ NFV 6
12 D4T+ NFV 47
13 DDI+ 3TC+ APV 39
14 D4T+ DDI+ EFV+ APV + RTV 47
15 None 78
16 ABC+ D4T+ FTC+ TDF 101

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, I84V, L90M L33F, G73GS L10I, I13IV, K20X, E35D, M36L, N37D, I62V, L63P, C67F, G68GE, H69HQ, A71IV, I72IM  
>CA48113| codons 1-99
PQITLWQRPIVTVKIGGQLXEALLDTGADDTVFEDLDLPGRWKPKMIGGIGGFVKVRQYD
QVPIEIFEQKVMSTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74LI, M184V, L210W, T215Y K219N, N348I L100LI, K103N, Y181YC, G190GA A98AG, V179VF K20R, K43N, E44D, V118I, K122E, G196E, T200TA, E203EK, E204EK, Q207E, R211K, L228H, A272P, I293V, E297A, I329L, M357T, G359S  
>CA48114| codons 1-368
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELENDGKISKIGPENPYNTPV
FAIKKKNSTKWRKIVDFRELNKRTQDFWEVQLGIPHPGGIKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIFI
CQYVDDLYVASDLEIEQHRAKIKKLREHLWKWGFYTPDNKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQGQWTYQIYQEPFKILKTGKYARTRSA
HTNDVKQL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005