<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5058 CA48110 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 56
2 AZT+DDC 47
3 3TC+D4T 65
4 3TC+D4T+NFV 91
5 3TC+D4T+IDV 30
6 3TC+D4T+RTV+SQV 21
7 3TC+EFV+IDV 104
8 3TC+EFV+IDV+TDF 74
9 3TC+ABC+EFV+IDV+TDF 49

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, T215Y   K101P, K103N   V35L, T39A, R83K, A98S, D123N, S162F, V179I, D192N, E204Q, H208Y, L210S, R211K, H221Y, D250E, V261VG, A272P, T286A, A288P, E297R, Q334E, G359S  
>CA48110| codons 1-363
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKIVDFRELNKKTQDFWEVQLGIPHPSGLPKNKSVTVLDVGDAYFSVPL
DKNFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQFSMTKILEPFRKQNPDIII
YQYVDDLYVGSNLEIGQHRTKIEQLRQYLSKWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLGGKLNWASQIYPGIKVKQLCKLLRGAKPLTEVIPLTREAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGEGQWTYQIYQEPFKNLKTGKYARMRSA
HTN

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73T L10V, E35D, L63S, I64V, H69R, A71V, I72V, I93L  
>CA48109| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKIIGGIGGFIKVRQYD
QISVEICGRKVVTTVLVGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005