<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8040 CA48108 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ABC+AZT+EFV 8
2 3TC+ABC+AZT 31
3 3TC+ABC+AZT+NVP 133

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74LI, Y115F, M184V, T215F K219E K103N   S3C, V35T, V60I, V90I, I94L, S162Y, I167V, E203D, H208Y, V245M, K249Q, A272P, T286A, I293V, P294S  
>CA48108| codons 1-301
PICPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKIVDFRELNKRTQDFWEIQLGLPHPAGLKKNKSVTVLDVGDAFFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKVLEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIDELRQYLLRWGFFTPDEKHQKEPPFLWMGYELHPDKWT
VQPIMLPEQDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVSLTEEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L33V, I64V  
>CA48107| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVVEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005