<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7920 CA48102 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 DDI+LPV+NVP 69
3 ABC+DDI+LPV+TDF 44
4 3TC+APV+D4T+RTV+SQV+TDF 66

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, L74V, M184V, L210W, T215Y K219Q K103N, Y181C V108I K20R, V60I, K101Q, K104R, K122KE, I135V, D177E, V189I, H208Y, R211K, D218E, H221Y, L228H, D237N, A272P, L283I, I293V, E297A  
>CA48102| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLQKNRSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYVDDLYIGSDLEIGQHRTKIEELRQYLWKWGFYTPEQKYQKEPPFHWMGYELHPNKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGTKALTEVVPLTAEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, I84V, L90M L33F, G73S L10I, I13V, R57K, I62V, L63P, A71T, I72T, V77I, I93L  
>CA48101| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKIIGGIGGFVKVKQYD
QVPIEICGHKTTSTVLIGPTPANVIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005