<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8049 CA48096 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 78
2 D4T+DDI+NFV 135
3 D4T+DDI+RTV+SQV 66
4 D4T+DDI+EFV+TDF 99
5 ATV+DDI+RTV+TDF 5

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R T215I, K219E G190E   V35L, S48SL, R83K, K101R, K103R, D177E, I178M, G196E, T200A, E204N, R211K, L228R, V245E, A272P, T286A, E297K D192DG, L205LP
>CA48096| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTEMEKEGKILKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLRKRKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYMDDLYVESGLEIEQHRAKIENPRQHLLKWGFITPDEKHQKEPPFRWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I54V, L90M L33I, N88D I13V, E35D, M36I, N37T, I62V, L63P, A71T  
>CA48095| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADNTVIEDITLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKTIGTVLVGPTPVNIIGRDLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005