<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6356 CA48093 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 139
2 3TC+AZT+IDV 48
3 3TC+AZT+SQV 35
4 3TC+AZT 78
5 D4T+DDI+NFV 52
6 D4T+EFV+NFV 165
7 D4T+NFV+TDF 64

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I   I13V, E35D, I62V, L63P, A71V, T74A, V77I, I93L  
>CA48093| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGHKVIGAVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, K70KR, L210LW, T215TNSY K219KHNQ K103KN P225PH E6K, E44ED, V118VI, K122E, I202IV, R211RK, V241VIM E53EK
>CA48094| codons 1-280
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPKNPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKVEELRQHLWKWGFYTPDQKHQKEHPFLWMGYELHPDKWT
MQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLC

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009