<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1290 CA48090 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 22
2 D4T 35
3 3TC+AZT+SQV 13
4 3TC+AZT+IDV 48
5 3TC+AZT+DDI+NFV+NVP 17
6 3TC+AZT+IDV 26
7 D4T+RTV+SQV 30
8 D4T+NFV+RTV+SQV 17
9 ABC+D4T+NFV+RTV+SQV 22
10 ABC+APV+D4T+NFV+RTV+SQV 26
11 3TC+APV+D4T+NFV+RTV+SQV 169
12 None 35
13 3TC+APV+RTV+SQV 26

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, T215F K219Q K103S   V118I, K122E, I178IM, V179VI, T200A, Q207EK, D218E, D250DA, A272P, T286TA, E297A  
>CA48090| codons 2-301
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVF
AIKKKNSTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKSKSVTVLDVGDAYFSIPLD
EDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMIIY
QYVDDLYVGSDLEIGQHRAKIEELRKHLLRWGFFTPEQKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKASWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTAEAEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54M, V82A, L90M L23I, L33F, K43T, F53L, G73T L10I, I15V, Q18H, K20R, E35D, M36I, N37D, K55R, D60E, L63P, I64V, C67F, H69K, I72IV, I93L  
>CA48089| codons 1-99
PQITLWQRPIVTIKVGGHLREAILDTGADDTVFEDIDLPGRWTPKIIGGIGGLMRVRQYE
QIPVEIFGKKAVTTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009