<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6583 CA48088 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 3TC+AZT 9
3 3TC+AZT+SQV 22
4 3TC+AZT+IDV 104
5 AZT+RTV+SQV 30
6 3TC+ABC+EFV 65
7 APV+D4T+RTV 35
8 3TC+AZT+LPV+NVP 48
9 APV+EFV+IDV+TDF 35
10 AZT+EFV+IDV+LPV 52
11 3TC+D4T+EFV+LPV+TDF 33

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184MV, L210W, T215Y V75VA, K219KN K103N, Y181C, G190GA V108I V35VI, K43N, A98S, V118VI, D177N, G196E, Q207H, H208HY, R211K, H221Y, A272S, T286A, E297K  
>CA48088| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELENEGKISKIGPENPYNTPV
FAIKKKNSTKWRKIADFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTILDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPNIVI
CQYVDDLYVASDLEIEQHRTKIEELRHYLWKWGFYTPDNKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGAKALTEVIPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI, M46MI, I47IV, I54IL, L90LM L10F, L33LF, G73GA R41KT, L63P, A71T, I72IR, V77I, I93L G78GR
>CA48087| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTIFEEMNLPGTWKPKIVGGIGGFLKVRQYD
QIPIEICGHKTRATVLIRPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005