<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1130 CA48079 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 D4T 32
3 3TC+ AZT 56
4 SQV+ RTV+ D4T+ 3TC 267
5 3TC+ ABC+ EFV+ TDF 23
6 3TC+ ABC+ AZT+ TDF 21
7 3TC+ ABC+ D4T+ TDF 13
8 Unknown 55

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, I84V, L90LM L33F, G73T L10I, T12S, I13V, R41RK, L63P, A71V, V77I, I93L  
>CA48079| codons 1-99
PQITLWQRPIVSVKIGGQLKEALLDTGADDTVFEEMNLPGKWKPKMIGGIGGFLKVRQYD
QIPIEICGHKVITTVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74LI, M184V, L210W, T215Y K219Q   A98AG E40X, K43E, E44EA, K64H, T69N, K122E, D123E, S162SN, Q174K, D177E, I178M, V179VI, Q207E, H208Y, R211K, L228H, Q242QH, A272P, I293IV  
>CA48080| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTXLEEAGKISKIGPENPYNTPV
FAIHKKNSNRWRKIVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRKKNPEMII
YQYVDDLYVGSDLEIGQHRTKIEELREYLWKWGFYTPDQKHQKEPPFHWMGYELHPDKWT
VHPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005