<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_799 TH_799 Thailand 2003 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NVP+ 3TC+ D4T 104

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Q151M A62V, V75I, F116Y Y181C, G190A   K20R, V35T, T39K, K43E, V60I, S68G, K122E, D123S, K173T, Q174K, D177E, I178M, Q207A, R211S, V245E  
>TH_799| codons 17-249
DGPRVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPIFVIKRKDGTKWRKLID
FRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSVPLDESFRKYTAFTIPSIN
NETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRTKNPEMVICQYMDDLYVASDLEIG
QHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIELPEK

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005