<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_797 TH_797 Thailand 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 RTV+ SQV+ D4T+ DDI 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V60I, S68G, D123E, I135V, S162A, K166R, D177E, R211G, V245E  
>TH_797| codons 19-250
PKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPIFAIKKKDGTKWRKLVDFR
ELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSVNNE
TPGIRYQYNVLPQGWKGSPAIFQASMTRILEPFRKQNPEIVIYQYMDDLYVGSDLEIGQH
RTKIEELRQHLLGWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIELPEKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005